PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA016861-PA
Common NameOsI_16838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 209aa    MW: 22650.8 Da    PI: 10.7441
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA016861-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.52e-092485165
          trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65
                      +Wt +e+laL +a++ +  +++r+ l  ++W++v+++      ++++ qC++k e+l++r +  +
  BGIOSGA016861-PA 24 CWTPDETLALARAYTARRLAVGRAHLTSADWAAVADAATP---TKTARQCRHKVEKLRRRLRSKR 85
                      8**********************************98766...57889***********998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.0E-72386No hitNo description
Gene3DG3DSA:1.10.10.607.1E-42581IPR009057Homeodomain-like
PROSITE profilePS500906.2492578IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MASSSPTNAA AAAAAAARRV PPPCWTPDET LALARAYTAR RLAVGRAHLT SADWAAVADA  60
ATPTKTARQC RHKVEKLRRR LRSKRRRPCP LLDAIDLLDG PSPSASPSQS PSPPPPASPP  120
PLPPAPSSPP PKKRRLPDGD ADADAEDDGE SDVVKALRAI GEGFLRAEQR RMEAARKTQQ  180
MRMEMALRHL DSQRRLMEAL VDRIIDSLE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17581KLRRRLR
27682LRRRLRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.48650.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976031100.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126120.0CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653630.13e-84PREDICTED: leiomodin-2-like, partial
TrEMBLA2XW191e-143A2XW19_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA016861-PA1e-142(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139112024